PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G050500.1
Common NameB456_007G050500, LOC105802191
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ZF-HD
Protein Properties Length: 298aa    MW: 33488.7 Da    PI: 9.1661
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G050500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.75.6e-3392147460
         ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                         +rY+eClkNh as+Ggh+vDGCgEfmps ge+gt++alkCaAC+CHRnFHR+e + e
  Gorai.007G050500.1  92 IRYRECLKNHVASMGGHVVDGCGEFMPS-GEDGTQEALKCAACECHRNFHRKEIDGE 147
                         79*************************9.999********************98865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.2E-3092144IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-2192145IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.8E-3093144IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.1994143IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.2E-29219295IPR009057Homeodomain-like
SuperFamilySSF466891.33E-19222294IPR009057Homeodomain-like
TIGRFAMsTIGR015656.5E-27233290IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MEVKGQDKEM GMPSSFSCNN KLNQADSSLK LSSSSAPINQ SRTLDQYNES NPSQHQIDNP  60
RSNPDHDRNP VSSPIPTVAA PTSTTISSTP LIRYRECLKN HVASMGGHVV DGCGEFMPSG  120
EDGTQEALKC AACECHRNFH RKEIDGETQY PATRCCFTYK NNARRGPVHP QQPTPLRQQR  180
FSLELSNSPC LPIAPAAMMN FRGGRAESSS EELNMFHSNE AGGRQPSYPQ SSKKRFRTKF  240
SRDQKDKMME FAEKLGWRIQ KQDEPEVQQF CAQVGVKRQV FKVWMHNSKQ AMKKKQM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-232322891673ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012489135.10.0PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ9ZPW71e-65ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A0D2S7740.0A0A0D2S774_G
STRINGPOPTR_0005s12420.12e-87(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.18e-65homeobox protein 24
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]